{"product_id":"proteintech-10530-1-ap","title":"Proteintech, 10530-1-AP, PDLIM5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PDLIM5 (10530-1-AP) by Proteintech is a Polyclonal antibody targeting PDLIM5 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples\n10530-1-AP targets PDLIM5 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HUVEC cells, A549 cells,  HeLa cells,  NIH\/3T3 cells,  MCF-7 cells,  MDA-MB-231 cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human stomach cancer tissue, mouse heart tissue,  mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPDLIM5 (PDZ and LIM domain 5), formerly known as enigma homolog (ENH), is a cytoplasmic protein containing PDZ domain and LIM domain at N terminus and C terminus, respectively. PDLIM5 gene generates several splicing variants, EZH1 to EZH4. The long isoform, ENH1, is widely expressed in various tissues including heart, brain, spleen, liver and kidney. In comparison, shorter isoforms that lack the LIM motifs are expressed in cardiac (ENH3) and skeletal muscle (ENH2, ENH3, and ENH4). ENH1 is essential for differentiation of striated muscles through interaction with other proteins. In addition, PDLIM5 is also involved in mood disorders, such as schizophrenia, bipolar disorder, and major depression. This antibody is specific to PDLIM5, and its specificity has been confirmed by siRNA test.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0808 Product name: Recombinant human PDLIM5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 351-596 aa of BC008741 Sequence: PVGSTGVIKSPSWQRPNQGVPSTGRISNSAAYSGSVAPANSALGQTQPSDQDTLVQRAEHIPAGKRTPMCAHCNQVIRGPFLVALGKSWHPEEFNCAHCKNTMAYIGFVEEKGALYCELCYEKFFAPECGRCQRKILGEVINALKQTWHVSCFVCVACGKPIRNNVFHLEDGEPYCETDYYALFGTICHGCEFPIEAGDMFLEALGYTWHDTCFVCSVCCESLEGQTFFSKKDKPLCKKHAHSVNF Predict reactive species\nFull Name: PDZ and LIM domain 5\nCalculated Molecular Weight: 64 kDa\nObserved Molecular Weight: 63-68 kDa\nGenBank Accession Number: BC008741\nGene Symbol: PDLIM5\nGene ID (NCBI): 10611\nRRID: AB_2161779\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96HC4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868920271017,"sku":"10530-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10530-1-ap","provider":"Iright","version":"1.0","type":"link"}