{"product_id":"proteintech-10544-1-ap","title":"Proteintech, 10544-1-AP, TAF9 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TAF9 (10544-1-AP) by Proteintech is a Polyclonal antibody targeting TAF9 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples\n10544-1-AP targets TAF9 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, MCF-7 cells,  human colon tissue,  human skeletal muscle tissue,  HEK-293 cells,  human heart tissue,  rat liver tissue\nPositive IP detected in: mouse skeletal muscle tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTAF9, also named as TAF2G, TAFII31, is a 264 amino acid protein, which belongs to the TAF9 family. TAF9 are involved in transcriptional activation as well as repression of distinct but overlapping sets of genes. TAF9 may have a role in gene regulation associated with apoptosis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0833 Product name: Recombinant human TAF9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-172 aa of BC007426 Sequence: MLLPNILLTGTPGVGKTTLGKELASKSGLKYINVGDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVDYHGCDFFPERWFHIVFVLRTDTNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQILKWIEQWIKDHNS Predict reactive species\nFull Name: TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa\nCalculated Molecular Weight: 28 kDa\nObserved Molecular Weight: 24-28 kDa\nGenBank Accession Number: BC007426\nGene Symbol: TAF9\nGene ID (NCBI): 6880\nRRID: AB_2271416\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q16594\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868974239913,"sku":"10544-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10544-1-ap","provider":"Iright","version":"1.0","type":"link"}