{"product_id":"proteintech-10552-1-ap","title":"Proteintech, 10552-1-AP, MOG1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MOG1 (10552-1-AP) by Proteintech is a Polyclonal antibody targeting MOG1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n10552-1-AP targets MOG1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SGC-7901 cells,  HepG2 cells,  mouse lung tissue,  mouse testis tissue\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRANGRF, also named as MOG1, RANGNRF, HSPC165, HSPC236 and MDS5, regulates the intracellular trafficking of RAN. In cardiac cells it regulates the cell surface localization of SCN5A.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0824 Product name: Recombinant human RANGRF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-165 aa of BC006486 Sequence: MEPTRDCPLFGGAFSAILPMGAIDVSDLRPVPDNQEVFCHPVTDQSLIVELLELQAHVRGEAAARYHFEDVGGVQGARAVHVESVQPLSLENLALRGRCQEAWVLSGKQQIAKENQQVRARECVMSWKGGSGDAEIQVSILTLIPLGSKGRDTSSGLAEAAPVPD Predict reactive species\nFull Name: RAN guanine nucleotide release factor\nCalculated Molecular Weight: 18 kDa\nObserved Molecular Weight: 18-22 kDa\nGenBank Accession Number: BC006486\nGene Symbol: RANGRF\nGene ID (NCBI): 29098\nRRID: AB_2238173\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9HD47\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869473394857,"sku":"10552-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10552-1-ap","provider":"Iright","version":"1.0","type":"link"}