{"product_id":"proteintech-10566-1-ap","title":"Proteintech, 10566-1-AP, GYS1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GYS1 (10566-1-AP) by Proteintech is a Polyclonal antibody targeting GYS1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n10566-1-AP targets GYS1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, K-562 cells,  Jurkat cells,  mouse skeletal muscle tissue,  rat heart tissue,  rat skeletal muscle tissue\nPositive IHC detected in: human liver tissue, human skeletal muscle tissue,  human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGYS1(Glycogen [starch] synthase, muscle) is the the rate limiting enzyme of the insulin-induced glycogenesis, transferring glucose units from UDP-Glc to a glycogen primer. It catalyzes the linear addition of glucose residues to the branching structure of glycogen, providing a convenient store of glucose for times of metabolic need. This protein has 2 isoforms produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0857 Product name: Recombinant human GYS1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 430-737 aa of BC007688 Sequence: RAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPEFLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEEHIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKYLGRYYMSARHMALSKAFPEHFTYEPNEADAAQGYRYPRPASVPPSPSLSRHSSPHQSEDEEDPRNGPLEEDGERYDEDEEAAKDRRNIRAPEWPRRASCTSSTSGSKRNSVDTATSSSLSTPSEPLSPTSSLGEERN Predict reactive species\nFull Name: glycogen synthase 1 (muscle)\nCalculated Molecular Weight: 84 kDa\nObserved Molecular Weight: 84 kDa\nGenBank Accession Number: BC007688\nGene Symbol: GYS1\nGene ID (NCBI): 2997\nRRID: AB_2116401\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P13807\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868871446697,"sku":"10566-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10566-1-ap","provider":"Iright","version":"1.0","type":"link"}