{"product_id":"proteintech-10590-1-ap","title":"Proteintech, 10590-1-AP, Cytokeratin 6A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Cytokeratin 6A (10590-1-AP) by Proteintech is a Polyclonal antibody targeting Cytokeratin 6A in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, rat samples\n10590-1-AP targets Cytokeratin 6A in WB, IHC, IF\/ICC, FC (Intra), CoIP, ChIP, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, MCF-7 cells,  HeLa cells,  A375 cells,  rat skin tissue,  U-251 cells\nPositive IHC detected in: human oesophagus cancer tissue, human breast cancer tissue,  human skin tissue,  human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A431 cells, HeLa cells\nPositive FC (Intra) detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:10000-1:50000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKeratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells, which are classified into two major sequence types. Type I keratins are a group of acidic intermediate filament proteins, including K9-K23, and the hair keratins Ha1-Ha8. Type II keratins are the basic or neutral courterparts to the acidic type I keratins, including K1-K8, and the hair keratins, Hb1-Hb6. Keratin 6 is a type II keratin. It is used as marker for epidermal hyperproliferation and differentiation. Three are three keratin 6 isoforms: ketatin 6A,6B and 6C. They share more than 99% identical DNA sequence.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0882 Product name: Recombinant human KRT6A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 364-564 aa of BC008807 Sequence: QVTAGRHGDDLRNTKQEIAEINRMIQRLRSEIDHVKKQCANLQAAIADAEQRGEMALKDAKNKLEGLEDALQKAKQDLARLLKEYQELMNVKLALDVEIATYRKLLEGEECRLNGEGVGQVNISVVQSTVSSGYGGASGVGSGLGLGGGSSYSYGSGLGVGGGFSSSSGRAIGGGLSSVGGGSSTIKYTTTSSSSRKSYKH Predict reactive species\nFull Name: keratin 6A\nCalculated Molecular Weight: 60 kDa\nObserved Molecular Weight: 56 kDa\nGenBank Accession Number: BC008807\nGene Symbol: Cytokeratin 6A\nGene ID (NCBI): 3853\nRRID: AB_2134306\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P02538\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868854177961,"sku":"10590-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10590-1-ap","provider":"Iright","version":"1.0","type":"link"}