{"product_id":"proteintech-10600-1-ap","title":"Proteintech, 10600-1-AP, CD24 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD24 (10600-1-AP) by Proteintech is a Polyclonal antibody targeting CD24 in WB, ELISA applications with reactivity to human, mouse, rat samples\n10600-1-AP targets CD24 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Daudi cells, mouse brain tissue,  rat spleen tissue,  Jurkat cells,  MCF-7 cells,  Raji cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD24 (known as heat stable antigen) is a small highly glycosylated GPI-linked sialoprotein. It is normally expressed at the surface of most B lymphocytes and differentiating neuroblasts, and it is also up-regulated in a wide variety of cancers. Studies have shown that CD24 functions in the regulation of B-cell apoptosis, leukocyte signal transduction, and leukocyte adhesion. Since it is highly glycosylated, the apparent molecular weight of CD24 could be variable, ranging from 30 kDa to 70 kDa.  (Ref: Akihiko Sano, MD., 2009)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0654 Product name: Recombinant human CD24 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-80 aa of BC007674 Sequence: MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAGGALQSTASLFVVSLSLLHLYS Predict reactive species\nFull Name: CD24 molecule\nCalculated Molecular Weight: 8 kDa\nObserved Molecular Weight: 30-70 kDa\nGenBank Accession Number: BC007674\nGene Symbol: CD24\nGene ID (NCBI): 100133941\nRRID: AB_10646440\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P25063\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868900970665,"sku":"10600-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10600-1-ap","provider":"Iright","version":"1.0","type":"link"}