{"product_id":"proteintech-10622-1-ap","title":"Proteintech, 10622-1-AP, 14-3-3 Sigma Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe 14-3-3 Sigma (10622-1-AP) by Proteintech is a Polyclonal antibody targeting 14-3-3 Sigma in WB, IHC, ELISA applications with reactivity to human, mouse samples\n10622-1-AP targets 14-3-3 Sigma in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, A549 cells,  HeLa cells,  U2OS cells,  MCF-7 cells\nPositive IHC detected in: mouse skin tissue, human bowen diseaseNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:20000-1:100000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\n14-3-3 Sigma is a member 14-3-3 family of highly conserved proteins participating in diverse cellular processes including cell cycle progression. It is exclusively present in various epithelial cells, and alternatively named as human epithelial marker (HEM), or stratifin. Alteration of its expression has been linked to cancer.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0973 Product name: Recombinant human SFN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-248 aa of BC002995 Sequence: MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS Predict reactive species\nFull Name: stratifin\nCalculated Molecular Weight: 28 kDa\nObserved Molecular Weight: 28-30 kDa\nGenBank Accession Number: BC002995\nGene Symbol: 14-3-3 Sigma\nGene ID (NCBI): 2810\nRRID: AB_2254479\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P31947\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869441446057,"sku":"10622-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10622-1-ap","provider":"Iright","version":"1.0","type":"link"}