{"product_id":"proteintech-10637-1-ap","title":"Proteintech, 10637-1-AP, XAB2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe XAB2 (10637-1-AP) by Proteintech is a Polyclonal antibody targeting XAB2 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n10637-1-AP targets XAB2 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  K-562 cells,  Y79 cells\nPositive IP detected in: K-562 cells\nPositive IHC detected in: rat salivary gland tissue, mouse salivary gland tissue,  mouse testis tissue,  rat testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nXPA-binding protein 2 (XAB2) a tetratricopeptide repeat protein involved in transcription-coupled DNA repair and transcription. XAB2 is involved in pre-mRNA splicing, transcription, and transcription-coupled DNA repair, leading to preimplantation lethality, and is essential for mouse embryogenesis. It interactes with Cockayne syndrome groups A and B (CSA and CSB) proteins and RNA polymerase II, which are known to be involved in transcription-coupled repair (TCR) and transcription, and that the antibodies against XAB2 protein inhibited the recovery of RNA synthesis after UV irradiation and normal RNA synthesis when microinjected into living fibroblasts.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0999 Product name: Recombinant human XAB2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 530-855 aa of BC007208 Sequence: EHKYFEESFKAYERGISLFKWPNVSDIWSTYLTKFIARYGGRKLERARDLFEQALDGCPPKYAKTLYLLYAQLEEEWGLARHAMAVYERATRAVEPAQQYDMFNIYIKRAAEIYGVTHTRGIYQKAIEVLSDEHAREMCLRFADMECKLGEIDRARAIYSFCSQICDPRTTGAFWQTWKDFEVRHGNEDTIKEMLRIRRSVQATYNTQVNFMASQMLKVSGSATGTVSDLAPGQSGMDDMKLLEQRAEQLAAEAERDQPLRAQSKILFVRSDASREELAELAQQVNPEEIQLGEDEDEDEMDLEPNEVRLEQQSVPAAVFGSLKED Predict reactive species\nFull Name: XPA binding protein 2\nCalculated Molecular Weight: 100 kDa\nObserved Molecular Weight: 100 kDa\nGenBank Accession Number: BC007208\nGene Symbol: XAB2\nGene ID (NCBI): 56949\nRRID: AB_2257336\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9HCS7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869509406889,"sku":"10637-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10637-1-ap","provider":"Iright","version":"1.0","type":"link"}