{"product_id":"proteintech-10676-1-ap","title":"Proteintech, 10676-1-AP, FABP3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FABP3 (10676-1-AP) by Proteintech is a Polyclonal antibody targeting FABP3 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n10676-1-AP targets FABP3 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue, rat testis tissue,  mouse skeletal muscle tissue,  rat heart tissue,  rat skeletal muscle tissue\nPositive IHC detected in: mouse heart tissue, human skin tissue,  human lung tissue,  human ovary tissue,  human breast cancer tissue,  human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFABP3 (fatty-acid-binding protein 3), also known as heart-type FABP or mammary-derived growth inhibitor (MDGI), is a small 15-kDa cytoplasmic protein transporting fatty acids and other lipophilic substances from the cytoplasm to the nucleus. It is most ubiquitously expressed in heart and skeletal muscle.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, sheep\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1069 Product name: Recombinant human FABP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-133 aa of BC007021 Sequence: MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA Predict reactive species\nFull Name: fatty acid binding protein 3, muscle and heart (mammary-derived growth inhibitor)\nCalculated Molecular Weight: 15 kDa\nObserved Molecular Weight: 15 kDa\nGenBank Accession Number: BC007021\nGene Symbol: FABP3\nGene ID (NCBI): 2170\nRRID: AB_2102309\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P05413\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868862730409,"sku":"10676-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10676-1-ap","provider":"Iright","version":"1.0","type":"link"}