{"product_id":"proteintech-10681-1-ap","title":"Proteintech, 10681-1-AP, NUDC Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NUDC (10681-1-AP) by Proteintech is a Polyclonal antibody targeting NUDC in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human samples\n10681-1-AP targets NUDC in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells,  HEK-293 cells,  HeLa cells,  K-562 cells,  SH-SY5Y cells\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells, HEK-293 cells,  HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNuclear distribution protein C (NudC) is a highly conserved dynein\/dynactin associated protein implicated in mitosis and cytokinesis. NudC is localized on major mitotic structures, and is involved in regulating spindle formation stability of kinetochore microtubule attachments, and chromosomes congression in early mitosis. NudC also is required for multi-protein transport along axons in neurons.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0998 Product name: Recombinant human NUDC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-331 aa of BC006147 Sequence: MGGEQEEERFDGMLLAMAQQHEGGVQELVNTFFSFLRRKTDFFIGGEEGMAEKLITQTFSHHNQLAQKTRREKRARQEAERREKAERAARLAKEAKSETSGPQIKELTDEEAERLQLEIDQKKDAENHEAQLKNGSLDSPGKQDTEEDEEEDEKDKGKLKPNLGNGADLPNYRWTQTLSELDLAVPFCVNFRLKGKDMVVDIQRRHLRVGLKGQPAIIDGELYNEVKVEESSWLIEDGKVVTVHLEKINKMEWWSRLVSSDPEINTKKINPENSKLSDLDSETRSMVEKMMYDQRQKSMGLPTSDEQKKQEILKKFMDQHPEMDFSKAKFN Predict reactive species\nFull Name: nuclear distribution gene C homolog (A. nidulans)\nCalculated Molecular Weight: 38 kDa\nObserved Molecular Weight: 42-45 kDa\nGenBank Accession Number: BC006147\nGene Symbol: NUDC\nGene ID (NCBI): 10726\nRRID: AB_2282933\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y266\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868985610409,"sku":"10681-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10681-1-ap","provider":"Iright","version":"1.0","type":"link"}