{"product_id":"proteintech-10683-1-ap","title":"Proteintech, 10683-1-AP, CDC23 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CDC23 (10683-1-AP) by Proteintech is a Polyclonal antibody targeting CDC23 in WB, ELISA applications with reactivity to human, mouse, rat samples\n10683-1-AP targets CDC23 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MOLT-4 cells, HEK-293 cells,  Jurkat cells,  K-562 cells,  Caco-2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCDC23(cell division cycle protein 23 homolog) is also named ANAPC8 and belongs to the APC8\/CDC23 family. It is a subunit of the anaphase-promoting complex (APC), which functions at the metaphase-to-anaphase transition of the cell cycle and is regulated by spindle checkpoint proteins. It can be phosphorylated and the phosphorylation of Thr-562 occurs specifically during mitosis(PMID:19690332). It has 3 isoforms produced by alternative splicing with the molecular weight of 69 kDa, 17 kDa, and 56 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1068 Product name: Recombinant human CDC23 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-126 aa of BC005258 Sequence: MVPVAVTAAVAPVLSINSDFSDLREIKKQLLLIAGLTRERGLLHSSKWSAELAFSLPALPLAELQPPPPITEEDAQDMDAYTLAKAYFDVKEYDRAAHFLHGCNSKKAYFLYMYSRYLVRAILKCH Predict reactive species\nFull Name: cell division cycle 23 homolog (S. cerevisiae)\nCalculated Molecular Weight: 68 kDa\nObserved Molecular Weight: 69 kDa\nGenBank Accession Number: BC005258\nGene Symbol: CDC23\nGene ID (NCBI): 8697\nRRID: AB_2075008\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UJX2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869654208681,"sku":"10683-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10683-1-ap","provider":"Iright","version":"1.0","type":"link"}