{"product_id":"proteintech-10684-1-ap","title":"Proteintech, 10684-1-AP, ETV4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ETV4 (10684-1-AP) by Proteintech is a Polyclonal antibody targeting ETV4 in WB, ELISA applications with reactivity to human samples\n10684-1-AP targets ETV4 in WB, IHC, IF, ChIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: BxPC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nETS translocation variant 4 (ETV4), also named as E1A-F or PEA3, is 484 amino acid protein, which contains one ETS DNA-binding domain and belongs to the ETS family. The calculated molecular weight of ETV4 protein is 54 kDa, but the phosphorylated ETV4 is a 54-61 kDa protein. ETV4 as a transcription activator localizes in the nucleus and binds to the enhancer of the adenovirus E1A gene.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, chicken\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0984 Product name: Recombinant human ETV4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-207 aa of BC007242 Sequence: MYLHTEGFSGPSPGDGAMGYGYEKPLRPFPDDVCVVPEKFEGDIKQEGVGAFREGPPYQRRGALQLWQFLVALLDDPTNAHFIAWTGRGMEFKLIEPEEVARLWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCEPEALFSLAFPDNQRPALKAEFDRPVSEEDTVPLSHLDESPAYLPELAGPAQPFGPKGGYSY Predict reactive species\nFull Name: ets variant 4\nCalculated Molecular Weight: 54 kDa\nObserved Molecular Weight: 61-65 kDa\nGenBank Accession Number: BC007242\nGene Symbol: ETV4\nGene ID (NCBI): 2118\nRRID: AB_2100984\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P43268\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868858896553,"sku":"10684-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10684-1-ap","provider":"Iright","version":"1.0","type":"link"}