{"product_id":"proteintech-10693-1-ap","title":"Proteintech, 10693-1-AP, CUL4A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CUL4A (10693-1-AP) by Proteintech is a Polyclonal antibody targeting CUL4A in WB, IHC, ELISA applications with reactivity to human, mouse samples\n10693-1-AP targets CUL4A in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: NIH\/3T3 cells\nPositive IHC detected in: human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCullin proteins assemble a large number of RING E3 ubiquitin ligases, participating in the proteolysis through the ubiquitin-proteasome pathway. Two cullin 4 (CUL4) proteins, CUL4A (87 kDa) and CUL4B(104 kDa), have been identified. The two CUL4 sequences are 83% identical. They target certain proteins for degradation by binding protein DDB1 to form a CUL4-DDB1 ubiquitin ligase complex with DDB. They form two individual E3 ligases, DDB1-CUL4ADDB2 and DDB1-CUL4BDDB2 in this process. CUL4A appeared in both the nucleus and the cytosol, suggesting a more complex mechanism for entering the nucleus. CUL4B is localized in the nucleus and facilitates the transfer of DDB1 into the nucleus independently of DDB2.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1030 Product name: Recombinant human CUL4A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 460-759 aa of BC008308 Sequence: RLLVGKSASVDAEKSMLSKLKHECGAAFTSKLEGMFKDMELSKDIMVHFKQHMQNQSDSGPIDLTVNILTMGYWPTYTPMEVHLTPEMIKLQEVFKAFYLGKHSGRKLQWQTTLGHAVLKAEFKEGKKEFQVSLFQTLVLLMFNEGDGFSFEEIKMATGIEDSELRRTLQSLACGKARVLIKSPKGKEVEDGDKFIFNGEFKHKLFRIKINQIQMKETVEEQVSTTERVFQDRQYQIDAAIVRIMKMRKTLGHNLLVSELYNQLKFPVKPGDLKKRIESLIDRDYMERDKDNPNQYHYVA Predict reactive species\nFull Name: cullin 4A\nCalculated Molecular Weight: 77 kDa\nObserved Molecular Weight: 88 kDa\nGenBank Accession Number: BC008308\nGene Symbol: CUL4A\nGene ID (NCBI): 8451\nRRID: AB_10896455\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q13619\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868996325545,"sku":"10693-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10693-1-ap","provider":"Iright","version":"1.0","type":"link"}