{"product_id":"proteintech-10707-1-ap","title":"Proteintech, 10707-1-AP, CXCL11 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CXCL11 (10707-1-AP) by Proteintech is a Polyclonal antibody targeting CXCL11 in WB, IHC, ELISA applications with reactivity to human samples\n10707-1-AP targets CXCL11 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: IFN gamma, LPS and Brefeldin A treated THP-1 cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCXCL11, also known as IFN-inducible T-cell α-chemoattractant (I-TAC), is a member of the ELR-negative CXC chemokine family. It is produced by various cells including leukocytes, fibroblasts, and endothelial cells upon stimulation with interferons (IFNs). CXCL11 signals through the chemokine receptors CXCR3 and CXCR7 . This chemokine is associated with multiple functions such as chemotactic migration, regulation of cell proliferation and self-renewal, increasing cell adhesion, and modulation of angiostatic effects.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1087 Product name: Recombinant human CXCL11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-94 aa of BC005292 Sequence: MSVKGMAIALAVILCATVVQGFPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF Predict reactive species\nFull Name: chemokine (C-X-C motif) ligand 11\nCalculated Molecular Weight: 10 kDa\nObserved Molecular Weight: 10 kDa\nGenBank Accession Number: BC005292\nGene Symbol: CXCL11\nGene ID (NCBI): 6373\nRRID: AB_2088022\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O14625\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868978958505,"sku":"10707-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10707-1-ap","provider":"Iright","version":"1.0","type":"link"}