{"product_id":"proteintech-10716-1-ap","title":"Proteintech, 10716-1-AP, CGGBP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CGGBP1 (10716-1-AP) by Proteintech is a Polyclonal antibody targeting CGGBP1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n10716-1-AP targets CGGBP1 in WB, IHC, IF, IP, chIP, Dot Blot, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, mouse thymus tissue,  K-562 cells,  Raji cells,  HL-60 cells,  Jurkat cells,  rat thymus tissue\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCGGBP1, also named as CGGBP, is a 20 kDa CGG-binding protein. It binds to nonmethylated 5'-d(CGG)(n)-3' trinucleotide repeats in the FMR1 promoter. CGGBP1 may play a role in regulating FMR1 promoter. It is a bona fide midbody protein required for normal abscission and mitosis in general.(PMID:20832400)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1129 Product name: Recombinant human CGGBP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-167 aa of BC005222 Sequence: MERFVVTAPPARNRSKTALYVTPLDRVTEFGGELHEDGGKLFCTSCNVVLNHVRKSAISDHLKSKTHTKRKAEFEEQNVRKKQRPLTASLQCNSTAQTEKVSVIQDFVKMCLEANIPLEKADHPAVRAFLSRHVKNGGSIPKSDQLRRTYLPDGYENENQLLNSQDC Predict reactive species\nFull Name: CGG triplet repeat binding protein 1\nCalculated Molecular Weight: 19 kDa\nObserved Molecular Weight: 19-23 kDa\nGenBank Accession Number: BC005222\nGene Symbol: CGGBP1\nGene ID (NCBI): 8545\nRRID: AB_2079283\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UFW8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868939604137,"sku":"10716-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10716-1-ap","provider":"Iright","version":"1.0","type":"link"}