{"product_id":"proteintech-10728-1-ap","title":"Proteintech, 10728-1-AP, PRPF4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PRPF4 (10728-1-AP) by Proteintech is a Polyclonal antibody targeting PRPF4 in WB, IHC, ELISA applications with reactivity to human samples\n10728-1-AP targets PRPF4 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, Raji cells,  HEK-293 cells,  HepG2 cells,  K-562 cells\nPositive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPRPF4, also named as U4\/U6 small nuclear ribonucleoprotein Prp4, is a 522 amino acid protein, which contains seven WD repeats. PRPF4 localizes in the Nucleus speckle. PRPF4 \tparticipates in pre-mRNA splicing and is a part of the U4\/U5\/U6 tri-snRNP complex, one of the building blocks of the spliceosome.PRPF4-mediated phosphorylation of KLF13 plays a role in the regulation of CCL5 expression in T lymphocytes\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1193 Product name: Recombinant human PRPF4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 213-522 aa of BC001588 Sequence: ELHKSLRSLNNFCSQIGDDRPISYCHFSPNSKMLATACWSGLCKLWSVPDCNLLHTLRGHNTNVGAIVFHPKSTVSLDPKDVNLASCAADGSVKLWSLDSDEPVADIEGHTVRVARVMWHPSGRFLGTTCYDRSWRLWDLEAQEEILHQEGHSMGVYDIAFHQDGSLAGTGGLDAFGRVWDLRTGRCIMFLEGHLKEIYGINFSPNGYHIATGSGDNTCKVWDLRQRRCVYTIPAHQNLVTGVKFEPIHGNFLLTGAYDNTAKIWTHPGWSPLKTLAGHEGKVMGLDISSDGQLIATCSYDRTFKLWMAE Predict reactive species\nFull Name: PRP4 pre-mRNA processing factor 4 homolog (yeast)\nCalculated Molecular Weight: 58 kDa\nObserved Molecular Weight: 58 kDa\nGenBank Accession Number: BC001588\nGene Symbol: PRPF4\nGene ID (NCBI): 9128\nRRID: AB_2171027\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O43172\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869424832681,"sku":"10728-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10728-1-ap","provider":"Iright","version":"1.0","type":"link"}