{"product_id":"proteintech-10731-1-ap","title":"Proteintech, 10731-1-AP, MYOT Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MYOT (10731-1-AP) by Proteintech is a Polyclonal antibody targeting MYOT in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n10731-1-AP targets MYOT in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse skeletal muscle tissue, mouse heart tissue\nPositive IHC detected in: mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMYOT (myotilin) is a structural protein of the striated muscle Z-discs. It interacts with both actinin and filamin, forming a complex to maintain structural stability of muscles. In adult tissues, myotilin is mainly expressed in skeletal and cardiac muscles and in the peripheral nerves. Missense mutations of myotilin cause limb girdle muscular dystrophy 1A and some other myopathy. Two isoforms of MYOT exist due to the alternative splicing. This antibody can detect both of isoforms around 57 kDa and 35 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1112 Product name: Recombinant human MYOT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 191-498 aa of BC005376 Sequence: GPQNAAAVFQAQDDSGAQDSQQHNSEHARLQVPTSQVRSRSTSRGDVNDQDAIQEKFYPPRFIQVPENMSIDEGRFCRMDFKVSGLPAPDVSWYLNGRTVQSDDLHKMIVSEKGLHSLIFEVVRASDAGAYACVAKNRAGEATFTVQLDVLAKEHKRAPMFIYKPQSKKVLEGDSVKLECQISAIPPPKLFWKRNNEMVQFNTDRISLYQDNTGRVTLLIKDVNKKDAGWYTVSAVNEAGVTTCNTRLDVTARPNQTLPAPKQLRVRPTFSKYLALNGKGLNVKQAFNPEGEFQRLAAQSGLYESEEL Predict reactive species\nFull Name: myotilin\nCalculated Molecular Weight: 55 kDa\nObserved Molecular Weight: 55-57 kDa, 35 kDa\nGenBank Accession Number: BC005376\nGene Symbol: MYOT\nGene ID (NCBI): 9499\nRRID: AB_2297956\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UBF9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868935082153,"sku":"10731-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10731-1-ap","provider":"Iright","version":"1.0","type":"link"}