{"product_id":"proteintech-10743-1-ap","title":"Proteintech, 10743-1-AP, Centromere protein R Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Centromere protein R (10743-1-AP) by Proteintech is a Polyclonal antibody targeting Centromere protein R in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human samples\n10743-1-AP targets Centromere protein R in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells\nPositive IP detected in: K-562 cells\nPositive IHC detected in: human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nITGB3BP, also named as CENPR and NRIF3; is a transcription coregulator that can have both coactivator and corepressor functions. ITGB3BP acts as a coactivator for estrogen receptor alpha. It acts as a transcriptional corepressor via its interaction with the NFKB1 NF-kappa-B subunit, possibly by interfering with the transactivation domain of NFKB1. ITGB3BP induces apoptosis in breast cancer cells, but not in other cancer cells, via a caspase-2 mediated pathway that involves mitochondrial membrane permeabilization but does not require other caspases. ITGB3BP has five isoforms with MW 7 kDa, 13 kDa and 19-25 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1204 Product name: Recombinant human Centromere protein R protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-177 aa of BC009929 Sequence: MPVKRSLKLDGLLEENSFDPSKITRKKSVITYSPTTGTCQMSLFASPTSSEEQKHRNGLSNEKRKKLNHPSLTESKESTTKDNDEFMMLLSKVEKLSEEIMEIMQNLSSIQALEGSRELENLIGISCASHFLKREMQKTKELMTKVNKQKLFEKSTGLPHKASRHLDSYEFLKAILN Predict reactive species\nFull Name: integrin beta 3 binding protein (beta3-endonexin)\nCalculated Molecular Weight: 20 kDa\nObserved Molecular Weight: 25 kDa\nGenBank Accession Number: BC009929\nGene Symbol: ITGB3BP\nGene ID (NCBI): 23421\nRRID: AB_2128916\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q13352\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868978237609,"sku":"10743-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10743-1-ap","provider":"Iright","version":"1.0","type":"link"}