{"product_id":"proteintech-10752-1-ap","title":"Proteintech, 10752-1-AP, CNOT8 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CNOT8 (10752-1-AP) by Proteintech is a Polyclonal antibody targeting CNOT8 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse samples\n10752-1-AP targets CNOT8 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells,  HeLa cells,  mouse testis tissue\nPositive IP detected in: mouse testis tissue\nPositive IHC detected in: human prostate cancer tissue,  human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCCR4-NOT transcription complex subunit 8(CNOT8), is a ubiquitous transcription factor, which required for a diverse set of processes. The CCR4-NOT complex is a global regulator of RNA polymerase II, and functions as general transcription regulation complex. It consisted part by CCR4, NOT1 to NOT5, and CAF1. This is a  rabbit polyclonal antibody raised against the full-length chain of human CNOT8.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1201 Product name: Recombinant human CNOT8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-292 aa of BC017366 Sequence: MPAALVENSQVICEVWASNLEEEMRKIREIVLSYSYIAMDTEFPGVVVRPIGEFRSSIDYQYQLLRCNVDLLKIIQLGLTFTNEKGEYPSGINTWQFNFKFNLTEDMYSQDSIDLLANSGLQFQKHEEEGIDTLHFAELLMTSGVVLCDNVKWLSFHSGYDFGYMVKLLTDSRLPEEEHEFFHILNLFFPSIYDVKYLMKSCKNLKGGLQEVADQLDLQRIGRQHQAGSDSLLTGMAFFRMKELFFEDSIDDAKYCGRLYGLGTGVAQKQNEDVDSAQEKMSILAIINNMQQ Predict reactive species\nFull Name: CCR4-NOT transcription complex, subunit 8\nCalculated Molecular Weight: 34 kDa\nObserved Molecular Weight: 34 kDa\nGenBank Accession Number: BC017366\nGene Symbol: CNOT8\nGene ID (NCBI): 9337\nRRID: AB_2082470\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UFF9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868964016297,"sku":"10752-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10752-1-ap","provider":"Iright","version":"1.0","type":"link"}