{"product_id":"proteintech-10788-1-ap","title":"Proteintech, 10788-1-AP, RAB3C Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RAB3C (10788-1-AP) by Proteintech is a Polyclonal antibody targeting RAB3C in WB, IP, IHC, ELISA applications with reactivity to human,  mouse, rat samples\n10788-1-AP targets RAB3C in WB, IP, IF, IHC, ELISA applications and shows reactivity with human,  mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, human brain tissue,  mouse lung tissue,  rat brain tissues\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRab proteins are small molecular weight GTPases that control vesicular traffic in eukaryotic cells. A subset of Rab proteins, the Rab3 proteins (Rab3A, Rab3B, Rab3C, and Rab3D) are thought to play an important role in regulated exocytosis of vesicles. Although Rab3 proteins are highly homologous, displaying 77-85% amino acid identity with greatest variance evident within the N- and C-terminal regions, their subcellular targets and functional roles remain somewhat distinct between them. RT-PCR analysis indicated that human Rab3C was expressed in the human brain, placenta, and lung.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1241 Product name: Recombinant human RAB3C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-227 aa of BC013033 Sequence: MRHEAPMQMASAQDARYGQKDSSDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFKNEKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVILVGNKCDMEDERVISTERGQHLGEQLGFEFFETSAKDNINVKQTFERLVDIICDKMSESLETDPAITAAKQNTRLKETPPPPQPNCAC Predict reactive species\nFull Name: RAB3C, member RAS oncogene family\nCalculated Molecular Weight: 26 kDa\nObserved Molecular Weight: 28 kDa\nGenBank Accession Number: BC013033\nGene Symbol: RAB3C\nGene ID (NCBI): 115827\nRRID: AB_2177217\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96E17\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869008122025,"sku":"10788-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10788-1-ap","provider":"Iright","version":"1.0","type":"link"}