{"product_id":"proteintech-10790-1-ap","title":"Proteintech, 10790-1-AP, ARF1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ARF1 (10790-1-AP) by Proteintech is a Polyclonal antibody targeting ARF1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat, monkey samples\n10790-1-AP targets ARF1 in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, monkey samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, COS-7 cells,  HEK-293 cells,  HeLa cells,  rat brain tissue\nPositive IHC detected in: human breast cancer tissue, human prostate cancer tissue,  human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nADP-ribosylation factors (ARFs) are members of the ARF family of GTP-binding proteins of the Ras superfamily, with 20 kDa protein size. ARFs bind and regulate GTP\/GDP cycle by alternating between the active GTP-bound and inactive GDP-bound conformations. ARF family proteins are essential and ubiquitous in eukaryotes. Six highly conserved members of the family have been identified in mammalian cells. They function in vesicular traffic and actin remodelling and other bioprocesses in cells. The ARF1 protein is localized to the Golgi apparatus and has a central role in intra-Golgi transport. It mainly functions in coat recruitment. (PMID: 7759471, PMID: 16042562).This antibody can bind ARFs for the close sequences.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, monkey\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1244 Product name: Recombinant human ARF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-181 aa of BC009247 Sequence: MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK Predict reactive species\nFull Name: ADP-ribosylation factor 1\nCalculated Molecular Weight: 21 kDa\nObserved Molecular Weight: 18-21 kDa\nGenBank Accession Number: BC009247\nGene Symbol: ARF1\nGene ID (NCBI): 375\nRRID: AB_2227609\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P84077\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868857389225,"sku":"10790-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10790-1-ap","provider":"Iright","version":"1.0","type":"link"}