{"product_id":"proteintech-10809-1-ap","title":"Proteintech, 10809-1-AP, LIX\/CXCL5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LIX\/CXCL5 (10809-1-AP) by Proteintech is a Polyclonal antibody targeting LIX\/CXCL5 in WB, IHC, ELISA applications with reactivity to human samples\n10809-1-AP targets LIX\/CXCL5 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PMA treated A549 cells\nPositive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nChemokines are a class of pro-inflammatory cytokines that can recruit and activate chemotactic cells. CXCL5 is a member of the chemokine family binding CXCR2, a G-protein coupled receptor. CXCL5 is a chemokine that promotes tumor formation by triggering the migration of immune cells to tumors and promotes immmuno-suppressive characteristics of the tumor microenvironment. CXCL5 can also promote tumor cell metastasis and recruit vascular endothelial cells for angiogenesis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1079 Product name: Recombinant human CXCL5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-114 aa of BC008376 Sequence: MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIASAGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN Predict reactive species\nFull Name: chemokine (C-X-C motif) ligand 5\nCalculated Molecular Weight: 12 kDa\nObserved Molecular Weight: 10-12 kDa\nGenBank Accession Number: BC008376\nGene Symbol: CXCL5\nGene ID (NCBI): 6374\nRRID: AB_2292366\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P42830\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869555216553,"sku":"10809-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10809-1-ap","provider":"Iright","version":"1.0","type":"link"}