{"product_id":"proteintech-10823-1-ap","title":"Proteintech, 10823-1-AP, Cystatin B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Cystatin B (10823-1-AP) by Proteintech is a Polyclonal antibody targeting Cystatin B in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human samples\n10823-1-AP targets Cystatin B in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human saliva tissue, MCF-7 cells,  HepG2 cells,  human saliva\nPositive IP detected in: MCF-7 cells\nPositive IHC detected in: human colon tissue, human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells, HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCystatin B (CSTB), a member of the cystatin superfamily protein, is a stefin that functions as an intracellular thiol protease inhibitor and has been thought to play a role in protecting against the proteases leaking from lysosomes. CSTB plays various functions in a variety of diseases, including epithelial ovarian cancer, colon cancer, and myoclonus epilepsy. Evidence indicates that mutations in CSTB are responsible for the primary defects in patients with progressive myoclonic epilepsy (EPM1). One type of mutation responsible for EPM1 is the expansion in the promoter region of this gene of a CCCCGCCCCGCG repeat from 2-3 copies to 30-78 copies.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1262 Product name: Recombinant human CSTB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-98 aa of BC003370 Sequence: MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF Predict reactive species\nFull Name: cystatin B (stefin B)\nCalculated Molecular Weight: 11 kDa\nObserved Molecular Weight: 11 kDa\nGenBank Accession Number: BC003370\nGene Symbol: Cystatin B\nGene ID (NCBI): 1476\nRRID: AB_2086100\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P04080\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869529198761,"sku":"10823-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10823-1-ap","provider":"Iright","version":"1.0","type":"link"}