{"product_id":"proteintech-10832-1-ap","title":"Proteintech, 10832-1-AP, BMI1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BMI1 (10832-1-AP) by Proteintech is a Polyclonal antibody targeting BMI1 in WB, IF\/ICC, IP, ELISA applications with reactivity to human, mouse samples\n10832-1-AP targets BMI1 in WB, IHC, IF\/ICC, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HT-29 cells, A549 cells,  HEK-293 cells,  Calu-1 cells,  HeLa cells,  K-562 cells,  U-937 cells,  NIH\/3T3 cells,  mouse brain tissue,  rat brain tissue\nPositive IP detected in: HT-29 cells\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:300-1:1200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBMI- 1 is one of polycomb group genes, which together with Ring1 strongly enhances the E3 ubiquitin ligase activity of the Ring2 catalytic subunit. Bmi1 plays an important role in the regulation of cell proliferation and senescence through repression of the p16Ink4a and p19Arf genes and is required for maintenance of adult hematopoietic and neural stem cells. The antibody 10832-1-AP detected proteins of 45-48kda, which may include phosphorylated isoforms of the protein.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1286 Product name: Recombinant human BMI1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-326 aa of BC011652 Sequence: MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADEDKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKSSVNGSSATSSG Predict reactive species\nFull Name: BMI1 polycomb ring finger oncogene\nCalculated Molecular Weight: 37 kDa\nObserved Molecular Weight: 37-43 kDa\nGenBank Accession Number: BC011652\nGene Symbol: BMI1\nGene ID (NCBI): 648\nRRID: AB_2065392\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P35226\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868848869545,"sku":"10832-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10832-1-ap","provider":"Iright","version":"1.0","type":"link"}