{"product_id":"proteintech-10834-1-ap","title":"Proteintech, 10834-1-AP, LSM4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LSM4 (10834-1-AP) by Proteintech is a Polyclonal antibody targeting LSM4 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n10834-1-AP targets LSM4 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF7 cells,  human placenta tissue,  MDA-MB-231 cells\nPositive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSm-like proteins, such as LSM4, were identified in a variety of organisms based on sequence homology with the Sm protein family. Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1280 Product name: Recombinant human LSM4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-139 aa of BC022198 Sequence: MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDEIIDMVKEEVVAKGRGRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGRQAGKQ Predict reactive species\nFull Name: LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae)\nCalculated Molecular Weight: 15 kDa\nObserved Molecular Weight: 15 kDa\nGenBank Accession Number: BC022198\nGene Symbol: LSM4\nGene ID (NCBI): 25804\nRRID: AB_2138361\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y4Z0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869470216361,"sku":"10834-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10834-1-ap","provider":"Iright","version":"1.0","type":"link"}