{"product_id":"proteintech-10853-1-ap","title":"Proteintech, 10853-1-AP, Palladin Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Palladin (10853-1-AP) by Proteintech is a Polyclonal antibody targeting Palladin in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse samples\n10853-1-AP targets Palladin in WB, IHC, IF\/ICC, FC (Intra), IP, COIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells,  A549 cells\nPositive IP detected in: HeLa cells, HEK-293 cells\nPositive IHC detected in: human colon cancer tissue, human breast cancer tissue,  human colon tissue,  human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPalladin is an actin associated protein serving as a cytoskeleton scaffold, and actin cross linker, localizing at stress fibers, focal adhesions, and other actin based structures. Palladin exists as multiple isoforms through alternative transcription initiation sites and splicing. There are three major isoforms (200, 140, 90-92 kDa) and multiple minor isoforms. Different palladin isoforms are expressed in a tissue-specific pattern during development and in adult organs: the 200 kDa isoform is predominantly expressed in the heart, skeletal muscle, testis and bone; the 140 kDa isoform is widely expressed with the exception of liver, muscle, and skin; the 90-92 kDa isoform is broadly expressed in embryonic tissues and highly expressed in adult smooth muscle tissues (21455759). Recently overexpression of palladin has been linked to the promoted invasive motility in several types of cancers (18978809, 22291919). The 85-90 kDa palladin isoform has been observed predominantly expressed in pancreatic ductal adenocarcinoma (PDA) while a 65 kDa isoform is expressed in normal pancreas and non-PDA tumors (20436683). This antibody, generated against the fragment 999-1383aa of palladin, recognizes most isoforms of this protein, except isoform 6.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1288 Product name: Recombinant human PALLD,palladin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 127-510 aa of BC013867 Sequence: APFFEMKLKHYKIFEGMPVTFTCRVAGNPKPKIYWFKDGKQISPKSDHYTIQRDLDGTCSLHTTASTLDDDGNYTIMAANPQGRISCTGRLMVQAVNQRGRSPRSPSGHPHVRRPRSRSRDSGDENEPIQERFFRPHFLQAPGDLTVQEGKLCRMDCKVSGLPTPDLSWQLDGKPVRPDSAHKMLVRENGVHSLIIEPVTSRDAGIYTCIATNRAGQNSFSLELVVAAKEAHKPPVFIEKLQNTGVADGYPVRLECRVLGVPPPQIFWKKENESLTHSTDRVSMHQDNHGYICLLIQGATKEDAGWYTVSAKNEAGIVSCTARLDVYTQWHQQSQSTKPKKVRPSASRYAALSDQGLDIKAAFQPEANPSHLTLNTALVESEDL Predict reactive species\nFull Name: palladin, cytoskeletal associated protein\nCalculated Molecular Weight: 1383 aa, 151 kDa\nObserved Molecular Weight: 95 kDa, 140 kDa\nGenBank Accession Number: BC013867\nGene Symbol: palladin\nGene ID (NCBI): 23022\nRRID: AB_2158782\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8WX93\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868833927337,"sku":"10853-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10853-1-ap","provider":"Iright","version":"1.0","type":"link"}