{"product_id":"proteintech-10856-1-ap","title":"Proteintech, 10856-1-AP, Histone H2A.X Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Histone H2A\n10856-1-AP targets Histone H2A.X in WB, IHC, IF\/ICC, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HL-60 cells,  HEK-293 ells,  mouse heart,  mouse kidney,  rat kidney\nPositive IHC detected in: human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells, U-251 cells,  U2OS cells\nPositive ChIP detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:1000-1:4000\nChromatin immunoprecipitation (ChIP): CHIP : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHistone H2A.X belongs to the histone H2A family, which is synthesized in G1 and S phase. It is involved in nucleosomal organization of chromatin together with other histone proteins, and is specially important for recombination between immunoglobulin switch regions. H2A.X becomes phosphorylated on serine 139 (to form gamma-H2AFX or H2AX139ph) in response to DNA double strand breaks (DSBs) generated by exogenous genotoxic agents and by stalled replication forks, which promotes DNA repair and maintains genomic stability. The calculated molecular weight of H2AX is 15 kDa, but the ubiquitinated H2A.X is about 22 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1305 Product name: Recombinant human Histone H2A.X protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-143 aa of BC013416 Sequence: MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY Predict reactive species\nFull Name: H2A histone family, member X\nCalculated Molecular Weight: 15 kDa\nObserved Molecular Weight: 15-18 kDa\nGenBank Accession Number: BC013416\nGene Symbol: Histone H2A.X\nGene ID (NCBI): 3014\nRRID: AB_2114985\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P16104\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887956775081,"sku":"10856-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10856-1-ap","provider":"Iright","version":"1.0","type":"link"}