{"product_id":"proteintech-10909-1-ap","title":"Proteintech, 10909-1-AP, DUSP13 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DUSP13 (10909-1-AP) by Proteintech is a Polyclonal antibody targeting DUSP13 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n10909-1-AP targets DUSP13 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue, human skeletal muscle tissue,  rat testis tissue\nPositive IP detected in: mouse testis tissue\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:100-1:1600\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1348 Product name: Recombinant human DUSP13 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-198 aa of BC009778 Sequence: MDSLQKQDLRRPKIHGAVQASPYQPPTLASLQRLLWVRQAATLNHIDEVWPSLFLGDAYAARDKSKLIQLGITHVVNAAAGKFQVDTGAKFYRGMSLEYYGIEADDNPFFDLSVYFLPVARYIRAALSVPQGRVLVHCAMGVSRSATLVLAFLMIYENMTLVEAIQTVQAHRNICPNSGFLRQLQVLDNRLGRETGRF Predict reactive species\nFull Name: dual specificity phosphatase 13\nCalculated Molecular Weight: 22 kDa, 36 kDa\nObserved Molecular Weight: 22 kDa, 36 kDa\nGenBank Accession Number: BC009778\nGene Symbol: DUSP13\nGene ID (NCBI): 51207\nRRID: AB_2230734\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UII6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869677179049,"sku":"10909-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10909-1-ap","provider":"Iright","version":"1.0","type":"link"}