{"product_id":"proteintech-10919-1-ap","title":"Proteintech, 10919-1-AP, SF3B2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SF3B2 (10919-1-AP) by Proteintech is a Polyclonal antibody targeting SF3B2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n10919-1-AP targets SF3B2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, K-562 cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSF3B (splicing factor 3B) is a U2 snRNP-associated protein complex essential for spliceosome assembly. SF3B complex contains the spliceosome-associated protein (SAP) 49, 130, 145, and 155 has been demonstrated. And this complex is essential for U2 snRNP to anchor to the pre-mRNA.  Splicing factor 3B subunit 2 (SF3B2), known as SAP145, forms complex with SAP49 which plays a role in cell cycle progression. SAP145, with predicated MW of 100 kDa, appears with MW of about 145 kDa which may be due to the post-translational modification.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1009 Product name: Recombinant human SF3B2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 331-636 aa of BC007610 Sequence: LYYEGKEFETRLKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYGPPPSYPNLKIPG LNSPIPESCSFGYHAGGWGKPPVDETGKPLYGDVFGTNAAEFQTKTEEEEIDRTPWGELEPSD EESSEEEEEEESDEDKPDETGFITPADSGLITPGGFSSVPAGMETPELIELRKKKIEEAMDGSETPQ LFTVLPEKRTATVGGAMMGSTHIYDMSTVMSRKGPAPELQGVEVALAPEELELDPMAMTQKY EEHVREQQAQVEKEDFSDMVAEHAAKQKQKKRKAQPQDSRGGSKKYKEFKF Predict reactive species\nFull Name: splicing factor 3b, subunit 2, 145kDa\nCalculated Molecular Weight: 100 kDa\nObserved Molecular Weight: 130-140 kDa\nGenBank Accession Number: BC007610\nGene Symbol: SF3B2\nGene ID (NCBI): 10992\nRRID: AB_2285782\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q13435\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868973551785,"sku":"10919-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10919-1-ap","provider":"Iright","version":"1.0","type":"link"}