{"product_id":"proteintech-10934-1-ap","title":"Proteintech, 10934-1-AP, Cyclin D2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Cyclin D2 (10934-1-AP) by Proteintech is a Polyclonal antibody targeting Cyclin D2 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n10934-1-AP targets Cyclin D2 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Caco-2 cells, MCF-7 cells,  NIH\/3T3 cells,  U2OS cells,  HEK-293 cells\nPositive IHC detected in: human renal cell carcinoma tissue, human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCCND2  belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. CCND2 forms a complex with and functions as a regulatory subunit of CDK4 or CDK6, whose activity is required for cell cycle G1\/S transition. CCND2 has been shown to interact with and be involved in the phosphorylation of tumor suppressor protein Rb. High level expression of CCND2 was observed in ovarian and testicular tumors.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat, pig, bovine, sheep, goat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1377 Product name: Recombinant human CCND2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-289 aa of BC010958 Sequence: MELLCHEVDPVRRAVRDRNLLRDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATWMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKSHLQLLGAVCMFLASKLKETSPLTAEKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQQREKLSLIRKHAQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDEEVSSLTCDALTELLAKITNTDVDCLKACQEQIEAVLLNSLQQYRQDQRDGSKSEDELDQASTPTDVRDIDL Predict reactive species\nFull Name: cyclin D2\nCalculated Molecular Weight: 32 kDa\nObserved Molecular Weight: 34 kDa\nGenBank Accession Number: BC010958\nGene Symbol: Cyclin D2\nGene ID (NCBI): 894\nRRID: AB_2275319\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P30279\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868837367977,"sku":"10934-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10934-1-ap","provider":"Iright","version":"1.0","type":"link"}