{"product_id":"proteintech-10939-1-ap","title":"Proteintech, 10939-1-AP, FGF-7\/KGF Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FGF-7\/KGF (10939-1-AP) by Proteintech is a Polyclonal antibody targeting FGF-7\/KGF in WB, ELISA applications with reactivity to human, mouse samples\n10939-1-AP targets FGF-7\/KGF in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse spleen tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFibroblast growth factor 7 (FGF7), also called keratinocyte growth factor, is a member of the FGF superfamily, which has been reported to stimulate cell proliferation, differentiation, migration, and vascular angiogenesis. FGF7 is a potent epithelial cell-specific growth factor, whose mitogenic activity is predominantly exhibited in keratinocytes but not in fibroblasts and endothelial cells.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1372 Product name: Recombinant human FGF7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-97 aa of BC010956 Sequence: MHKWILTWILPTLLYRSCFHIICLVGTISLACNDMTPEQMATNVNCSSPERHTRSYDYMEGEDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYSK Predict reactive species\nFull Name: fibroblast growth factor 7 (keratinocyte growth factor)\nCalculated Molecular Weight: 22-28 kDa\nObserved Molecular Weight: 23 kDa\nGenBank Accession Number: BC010956\nGene Symbol: FGF7\nGene ID (NCBI): 2252\nRRID: AB_2102816\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P21781\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887639056553,"sku":"10939-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10939-1-ap","provider":"Iright","version":"1.0","type":"link"}