{"product_id":"proteintech-10951-1-ap","title":"Proteintech, 10951-1-AP, PDHX Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PDHX (10951-1-AP) by Proteintech is a Polyclonal antibody targeting PDHX in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n10951-1-AP targets PDHX in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: BxPC-3 cells, HEK-293 cells,  SKOV-3 cells,  HepG2 cells,  NIH\/3T3 cells,  mouse kidney tissue\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPDHX (Pyruvate dehydrogenase protein X component), an E3-binding protein in the PDC, is acetylated by the p300 at Lys 488, impeding the interaction between PDHX and dihydrolipoyl transacetylase (E2), thereby disrupting PDC assembly to inhibit its activation (PMID: 30012170). PDHX was characterized as a metabolically essential gene for  esophageal squamous cell carcinoma (ESCC), and knockdown of PDHX inhibited the proliferation of cancer stem cells (CSCs) and in vivo tumor growth (PMID: 33964039). Western blot analysis detected PDHX at an apparent molecular mass of 54 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1389 Product name: Recombinant human PDHX protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-501 aa of BC010389 Sequence: MAASWRLGCDPRLLRYLVGFPGRRSVGLVKGALGWSVSRGANWRWFHSTQWLRGDPIKILMPSLSPTMEEGNIVKWLKKEGEAVSAGDALCEIETDKAVVTLDASDDGILAKIVVEEGSKNIRLGSLIGLIVEEGEDWKHVEIPKDVGPPPPVSKPSEPRPSPEPQISIPVKKEHIPGTLRFRLSPAARNILEKHSLDASQGTATGPRGIFTKEDALKLVQLKQTGKITESRPTPAPTATPTAPSPLQATAGPSYPRPVIPPVSTPGQPNAVGTFTEIPASNIRRVIAKRLTESKSTVPHAYATADCDLGAVLKVRQDLVKDDIKVSVNDFIIKAAAVTLKQMPDVNVSWDGEGPKQLPFIDISVAVATVKGLLTPIIKDAAAKGIQEIADSVKALSKKARDGKLLPEEYQGGSFSISNLGMFGIDEFTAVINPPQACILAVGRFRPVLKLTEDEEGNAKLQQRQLITVTMSSDSRVVDDELATRFLKSFKANLENPIRLA Predict reactive species\nFull Name: pyruvate dehydrogenase complex, component X\nCalculated Molecular Weight: 54 kDa\nObserved Molecular Weight: 54 kDa\nGenBank Accession Number: BC010389\nGene Symbol: PDHX\nGene ID (NCBI): 8050\nRRID: AB_2163102\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O00330\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868898611369,"sku":"10951-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10951-1-ap","provider":"Iright","version":"1.0","type":"link"}