{"product_id":"proteintech-10953-1-ap","title":"Proteintech, 10953-1-AP, HMGN2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HMGN2 (10953-1-AP) by Proteintech is a Polyclonal antibody targeting HMGN2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n10953-1-AP targets HMGN2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells,  HeLa cells,  HepG2 cells,  HL-60 cells,  K-562 cells\nPositive IHC detected in: human prostate cancer tissue,  human cervical cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHMGN2 is a highly conserved nucleosomal protein which may involve in unfolding higher-order chromatin structure and facilitating the transcriptional activation of mammalian genes. It is the most abundant, ubiquitous and evolutionarily conserved nonhistione proteins found in the nuclei of higher eukaryotes. It binds to the inner side of the nucleosomal DNA thus altering the interaction between the DNA and the histone octamer.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1401 Product name: Recombinant human HMGN2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-90 aa of BC014644 Sequence: MPKRKAEGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPKPKKAPAKKGEKVPKGKKGKADAGKEGNNPAENGDAKTDQAQKAEGAGDAK Predict reactive species\nFull Name: high-mobility group nucleosomal binding domain 2\nCalculated Molecular Weight: 9 aa, 3 kDa\nObserved Molecular Weight: 18-20 kDa\nGenBank Accession Number: BC014644\nGene Symbol: HMGN2\nGene ID (NCBI): 3151\nRRID: AB_2118482\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P05204\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868999635113,"sku":"10953-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10953-1-ap","provider":"Iright","version":"1.0","type":"link"}