{"product_id":"proteintech-10982-1-ap","title":"Proteintech, 10982-1-AP, OSMR Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe OSMR (10982-1-AP) by Proteintech is a Polyclonal antibody targeting OSMR in WB, ELISA applications with reactivity to human, monkey samples\n10982-1-AP targets OSMR in WB, IHC, IF, ELISA applications and shows reactivity with human, monkey samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, A2780 cells,  Raji cells,  HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nOncostatin M (OSM) is a member of interleukin-6 family cytokines that modulates proliferation and differentiation in numerous cells (PMID: 22982441). OSM signals via a receptor complex comprising gp130 and the OSMR (also called OSMRβ) (PMID: 8999038). OSMR is a single-pass membrane protein that belongs to the type I cytokine receptor family. OSMR mRNA is expressed at relatively high levels in all neural cells and fibroblast, epithelial, and various tumor cell lines (PMID: 8999038). It has also been shown that OSMR associates with IL31RA to form the heterodimeric IL31 receptor (PMID: 15184896). OMSR  has a calculated molecular weight of 110 kDa, with an apparent molecular weight of 150-180 kDa (PMID: 8999038; 17028186; 39266541; 34644107). A 70 kDa soluble form can be detected by western blot (PMID: 17028186).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, monkey\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1426 Product name: Recombinant human OSMR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-342 aa of BC010943 Sequence: MALFAVFQTTFFLTLLSLRTYQSEVLAERLPLTPVSLKVSTNSTRQSLHLQWTVHNLPYHQELKMVFQIQISRIETSNVIWVGNYSTTVKWNQVLHWSWESELPLECATHFVRIKSLVDDAKFPEPNFWSNWSSWEEVSVQDSTGQDILFVFPKDKLVEEGTNVTICYVSRNIQNNVSCYLEGKQIHGEQLDPHVTAFNLNSVPFIRNKGTNIYCEASQGNVSEGMKGIVLFVSKVLEEPKDFSCETEDFKTLHCTWDPGTDTALGWSKQPSQSYTLFESFSGEKKLCTHKNWCNWQITQDSQETYNFTLIAENYLRKRSVNILFNLTHRGETRVVTAHRGH Predict reactive species\nFull Name: oncostatin M receptor\nCalculated Molecular Weight: 110 kDa\nObserved Molecular Weight: 110 kDa\nGenBank Accession Number: BC010943\nGene Symbol: OSMR\nGene ID (NCBI): 9180\nRRID: AB_2156583\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q99650\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868882587817,"sku":"10982-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10982-1-ap","provider":"Iright","version":"1.0","type":"link"}