{"product_id":"proteintech-10987-1-ap","title":"Proteintech, 10987-1-AP, WASP Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe WASP (10987-1-AP) by Proteintech is a Polyclonal antibody targeting WASP in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n10987-1-AP targets WASP in WB, IHC, IP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HL-60 cells, K-562 cells,  mouse spleen tissue,  Jurkat cells,  Raji cells\nPositive IP detected in: Raji cells, rat spleen tissue\nPositive IHC detected in: human tonsillitis tissue, human lymphoma tissue,  human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:800-1:3200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nWiskott-Aldrich Syndrome protein (WASP) regulates actin cytoskeleton in hematopoietic cells and defects in WASP cause Wiskott-Aldrich Syndrome (WAS), an X-linked immunodeficiency and autoimmunity disorder of childhood.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1444 Product name: Recombinant human WAS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-163 aa of BC012738 Sequence: MSGGPMGGRPGGRGAPAVQQNIPSTLLQDHENQRLFEMLGRKCLTLATAVVQLYLALPPGAEHWTKEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYSQLVYSTPTPFFHTFAGDDCQAGLNFADEDEAQAFRALVQEKIQKRNQRQSGDRRQLPPPP Predict reactive species\nFull Name: Wiskott-Aldrich syndrome (eczema-thrombocytopenia)\nCalculated Molecular Weight: 53 kDa\nObserved Molecular Weight: 55-62 kDa\nGenBank Accession Number: BC012738\nGene Symbol: WASP\nGene ID (NCBI): 7454\nRRID: AB_2304546\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P42768\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869390262441,"sku":"10987-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10987-1-ap","provider":"Iright","version":"1.0","type":"link"}