{"product_id":"proteintech-11045-2-ap","title":"Proteintech, 11045-2-AP, GNB5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GNB5 (11045-2-AP) by Proteintech is a Polyclonal antibody targeting GNB5 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples\n11045-2-AP targets GNB5 in WB, IP, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, human brain tissue\nPositive IP detected in: rat brain tissue\nPositive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGuanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction. G proteins, which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1518 Product name: Recombinant human GNB5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-126 aa of BC011671 Sequence: MATEGLHENETLASLKSEAESLKGKLEEERAKLHDVELHQVAERVEALGQFVMKTRRTLKGHGNKVLCMDWCKDKRRIVSSSQDGKVIVWDSFTTNKVRHCSQPRYRGFRIPAYLKVLWSSCPALS Predict reactive species\nFull Name: guanine nucleotide binding protein (G protein), beta 5\nCalculated Molecular Weight: 39 kDa\nObserved Molecular Weight: 39-42 kDa\nGenBank Accession Number: BC011671\nGene Symbol: GNB5\nGene ID (NCBI): 10681\nRRID: AB_2109639\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O14775\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868980990121,"sku":"11045-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11045-2-ap","provider":"Iright","version":"1.0","type":"link"}