{"product_id":"proteintech-11063-1-ap","title":"Proteintech, 11063-1-AP, SYCE1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SYCE1 (11063-1-AP) by Proteintech is a Polyclonal antibody targeting SYCE1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n11063-1-AP targets SYCE1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue\nPositive IP detected in: mouse testis tissue\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSynaptonemal Complex Central Element 1 (Syce1) is a major component of the synaptonemal complex (SC), which is formed between homologous chromosomes during meiotic prophase and exists only during the first meiotic division. The SYCE1 structural core, formed by an N-terminal region of amino acids 25-179, is an α-helical dimer that adopts an anti-parallel \"coiled-coil\"-like structure of approximately 20 nm in length (PMID: 30607510). The male Syce1 null mice had abundant primary spermatocytes and lacked postmeiotic cells; arrested cells were likely eliminated by accelerated apoptosis ( PMID: 25899990).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1527 Product name: Recombinant human SYCE1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 112-271 aa of BC034821 Sequence: KNKQRQLRLAFEEQLEDLMGQHKDLWDFHMPERLAREICALDSSKEQLLKEEKLVKATLEDVKHQLCSLCGAEGPSTLDEGLFLRSQEAAATVQLFQEEHRKAEELLAAAAQRHQQLQQKCQQQQQKRQRLKEELEKHGMQVPAQAQSTQEEEAGPGDVA Predict reactive species\nFull Name: synaptonemal complex central element protein 1\nCalculated Molecular Weight: 315 aa, 36 kDa\nObserved Molecular Weight: 40-44 kDa\nGenBank Accession Number: BC034821\nGene Symbol: SYCE1\nGene ID (NCBI): 93426\nRRID: AB_2197057\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8N0S2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869386592425,"sku":"11063-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11063-1-ap","provider":"Iright","version":"1.0","type":"link"}