{"product_id":"proteintech-11067-2-ap","title":"Proteintech, 11067-2-AP, PROX1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PROX1 (11067-2-AP) by Proteintech is a Polyclonal antibody targeting PROX1 in WB, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human samples\n11067-2-AP targets PROX1 in WB, IF\/ICC, FC (Intra), IP, ChIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, human liver tissue,  MCF-7 cells,  HuH-7 cells\nPositive IP detected in: HepG2 cells\nPositive IF\/ICC detected in: HuH-7 cells\nPositive FC (Intra) detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nProspero-related homeobox 1 (Prox1) is a homeobox transcription factor involved in various developmental processes, including neurogenesis and lymphangiogenesis. In the central nervous system (CNS), it controls the maintenance, proliferation, and differentiation of neural stem cells. This is a rabbit polyclonal antibody raised against part of C-terminal chain of human PROX1. The calcualted molecular weight of PROX1 is 83 kDa.What is the molecular weight of KEAP1 protein? Is Prox1 post-translationally modified?The calculated molecular weight of Prox1 protein is 83 kDa but the observed weight is 95 kDa. Prox1 is a subject of SUMO-ylation at K556, which is important for its transcription activity and increases the molecular weight of Prox1 to 110 kDa (PMID: 19706680). Usually there is a pool of modified and unmodified Prox1 protein in cells and therefore it is quite common to observe two specific bands in western blotting using Prox1 antibody.What is the subcellular localization of Prox1?Prox1 contains a nuclear localization signal within its N-terminus and resides in the nucleus, where it acts as a transcription factor.What is the tissue expression pattern of Prox1 in the central nervous system?Prox1 expression in the central nervous system (CNS) depends on the developmental stage. During embryogenesis Prox1 is present in neuronal precursors located in the subventricular zone, while during fetal development it is additionally present in the cerebral and cerebellar cortex and hippocampus. Postnatally, Prox1 expression in the CNS is restricted to the dentate gyrus of the hippocampus and cerebellum (PMID: 17117441). Therefore, Prox1 can be used as a marker of a subset of neuronal progenitors, as well as a specific marker of dentate gyrus cell lineage, such as type-2 intermediate progenitors and mature granule cells.Is Prox1 expressed outside of the central nervous system?Yes. Prox1 is expressed in the developmental stages of the eye lens, liver, pancreas, heart, and the lymphatic system (PMID: 22733308). Prox1 is also expressed post-developmentally in lymphatic endothelial cells and is often used, together with VEGFR-3, as a marker for lymphatic vessels.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat, pig, goat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1543 Product name: Recombinant human PROX1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 546-736 aa of BC024201 Sequence: TAEGLSLSLIKSECGDLQDMSEISPYSGSAMQEGLSPNHLKKAKLMFFYTRYPSSNMLKTYFSDVKFNRCITSQLIKWFSNFREFYYIQMEKYARQAINDGVTSTEELSITRDCELYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCLQELLH Predict reactive species\nFull Name: prospero homeobox 1\nCalculated Molecular Weight: 737 aa, 83 kDa\nObserved Molecular Weight: 90 kDa\nGenBank Accession Number: BC024201\nGene Symbol: PROX1\nGene ID (NCBI): 5629\nRRID: AB_2268804\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q92786\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868841889961,"sku":"11067-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11067-2-ap","provider":"Iright","version":"1.0","type":"link"}