{"product_id":"proteintech-11108-1-ap","title":"Proteintech, 11108-1-AP, ACVR1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ACVR1 (11108-1-AP) by Proteintech is a Polyclonal antibody targeting ACVR1 in WB, ELISA applications with reactivity to human, mouse, rat samples\n11108-1-AP targets ACVR1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nACVR1 (activin receptor type I), also known as ALK2 or ACTRI, is a receptor for activin. It forms a stable complex with type II receptor after ligand binding. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine\/threonine specificity. Type I receptors are essential for signaling, and type II receptors are required for binding ligands and for expression of type I receptors. ACVR1 is expressed in many tissues including skeletal muscle and chondrocytes. It functions as a receptor for bone morphogenetic protein (BMP) and induces Indian hedgehog in chondrocytes during skeletal development. Mutations in ACVR1 gene are associated with fibrodysplasia ossificans progressive (PMID: 16642017).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1556 Product name: Recombinant human ACVR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 210-509 aa of BC033867 Sequence: LLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQGKPAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKIDNSLDKLKTDC Predict reactive species\nFull Name: activin A receptor, type I\nCalculated Molecular Weight: 509 aa, 57 kDa\nObserved Molecular Weight: 57 kDa\nGenBank Accession Number: BC033867\nGene Symbol: ACVR1\nGene ID (NCBI): 90\nRRID: AB_3085368\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q04771\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869801697449,"sku":"11108-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11108-1-ap","provider":"Iright","version":"1.0","type":"link"}