{"product_id":"proteintech-11109-1-ap","title":"Proteintech, 11109-1-AP, ETFDH Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ETFDH (11109-1-AP) by Proteintech is a Polyclonal antibody targeting ETFDH in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n11109-1-AP targets ETFDH in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, HEK-293 cells,  rat brain tissue,  mouse kidney tissue,  mouse skeletal muscle tissue,  rat kidney tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human liver cancer tissue, human liver tissue,  human kidney tissue,  human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nETFDH(Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial) is also named as ETF-QO and belongs to the ETF-QO\/fixC family.It is a 64-kDa monomer integrated in the inner mitochondrial membrane, con- tains one molecule of FAD and a 4Fe4S cluster(PMID:12815589).Defects in ETFDH are the cause of glutaric aciduria type 2C (GA2C).This antibody is speicific to ETFDH.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1568 Product name: Recombinant human ETFDH protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 269-617 aa of BC011890 Sequence: QTYGIGLKELWVIDEKNWKPGRVDHTVGWPLDRHTYGGSFLYHLNEGEPLVALGLVVGLDYQNPYLSPFREFQRWKHHPSIRPTLEGGKRIAYGARALNEGGFQSIPKLTFPGGLLIGCSPGFMNVPKIKGTHTAMKSGILAAESIFNQLTSENLQSKTIGLHVTEYEDNLKNSWVWKELYSVRNIRPSCHGVLGVYGGMIYTGIFYWILRGMEPWTLKHKGSDFERLKPAKDCTPIEYPKPDGQISFDLLSSVALSGTNHEHDQPAHLTLRDDSIPVNRNLSIYDGPEQRFCPAGVYEFVPVEQGDGFRLQINAQNCVHCKTCDIKDPSQNINWVVPEGGGGPAYNGM Predict reactive species\nFull Name: electron-transferring-flavoprotein dehydrogenase\nCalculated Molecular Weight: 64 kDa\nObserved Molecular Weight: 64 kDa\nGenBank Accession Number: BC011890\nGene Symbol: ETFDH\nGene ID (NCBI): 2110\nRRID: AB_2231382\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q16134\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868911390889,"sku":"11109-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11109-1-ap","provider":"Iright","version":"1.0","type":"link"}