{"product_id":"proteintech-11137-1-ap","title":"Proteintech, 11137-1-AP, MMAB Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MMAB (11137-1-AP) by Proteintech is a Polyclonal antibody targeting MMAB in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse samples\n11137-1-AP targets MMAB in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells,  BxPC-3 cells,  HepG2 cells,  L02 cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human ovarian cancer, human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe MMAB gene encodes cob(I)alamin adenosyltransferase, which catalyzes the final step in the synthesis of the coenzyme adenosylcobalamin (AdoCbl). AdoCbl is a vitamin B12-containing coenzyme for methylmalonyl-CoA mutase. The deduced 250-amino acid protein has a calculated molecular mass of 27.3 kD.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1602 Product name: Recombinant human MMAB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-250 aa of BC011831 Sequence: MAVCGLGSRLGLGSRLGLRGCFGAARLLYPRFQSRGPQGVEDGDRPQPSSKTPRIPKIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFALELVTEKGHTFAEELQKIQCTLQDVGSALATPCSSAREAHLKYTTFKAGPILELEQWIDKYTSQLPPLTAFILPSGGKISSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTLARYAAMKEGNQEKIYMKNDPSAESEGL Predict reactive species\nFull Name: methylmalonic aciduria (cobalamin deficiency) cblB type\nCalculated Molecular Weight: 27 kDa\nObserved Molecular Weight: 27 kDa\nGenBank Accession Number: BC011831\nGene Symbol: MMAB\nGene ID (NCBI): 326625\nRRID: AB_2235498\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96EY8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869416181929,"sku":"11137-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11137-1-ap","provider":"Iright","version":"1.0","type":"link"}