{"product_id":"proteintech-11159-1-ap","title":"Proteintech, 11159-1-AP, ABCD1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ABCD1 (11159-1-AP) by Proteintech is a Polyclonal antibody targeting ABCD1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n11159-1-AP targets ABCD1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human brain tissue,  HeLa cells,  mouse liver tissue\nPositive IP detected in: mouse liver tissue\nPositive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nABCD1 (also known as ALDP) is a member of the ATP-binding cassette (ABC) transporter superfamily which functions as transporter for a wide variety of substrates. It localizes to the peroxisomal membrane. The exact function is not clear so far. Various mutations of ABCD1 cause X-linked adrenoleukodystrophy (X-ALD), an inherited neurodegenerative disease affecting the nervous system white matter and adrenal cortex.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1635 Product name: Recombinant human ABCD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 334-507 aa of BC025358 Sequence: LMKYVWSASGLLMVAVPIITATGYSESDAEAVKKAALEKKEEELVSERTEAFTIARNLLTAAADAIERIMSSYKEVTELAGYTARVHEMFQVFEDVQRCHFKRPRELEDAQAGSGTIGRSGVRVEGPLKIRGQVVDVEQGIICENIPIVTPSGEVVVASLNIRVEEGMHLLITG Predict reactive species\nFull Name: ATP-binding cassette, sub-family D (ALD), member 1\nCalculated Molecular Weight: 745 aa, 83 kDa\nObserved Molecular Weight: 75 kDa\nGenBank Accession Number: BC025358\nGene Symbol: ABCD1\nGene ID (NCBI): 215\nRRID: AB_2219775\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P33897\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869511372969,"sku":"11159-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11159-1-ap","provider":"Iright","version":"1.0","type":"link"}