{"product_id":"proteintech-11176-1-ap","title":"Proteintech, 11176-1-AP, HNRNPA1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HNRNPA1 (11176-1-AP) by Proteintech is a Polyclonal antibody targeting HNRNPA1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat, pig samples\n11176-1-AP targets HNRNPA1 in WB, IHC, IF\/ICC, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, mouse colon tissue,  K-562 cells,  Neuro-2a cells,  C6 cells\nPositive IHC detected in: mouse pancreas tissue, human breast cancer tissue,  human colon tissue,  human colon cancer tissue,  human liver cancer tissue,  human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIn eukaryotic cells, nascent RNA polymerase II transcripts are associated in the nucleus with specific proteins to form ribonucleoprotein complexes called HNRP or 40S. Protein moiety of the HNRP particle has 6 major components called core proteins, and HNRPA1 is one of them. hnRNP A1 is a multifunctional RNA binding protein which is involved in pre-mRNA splicing, export of mature transcripts from the nucleus, mRNA turnover, and internal ribosome entry site (IRES)-mediated translation. HNRNPA1 has three isoforms with MW 30 kDa, 34 kDa and 39 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nCited Reactivity: human, mouse, rat, pig, zebrafish\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1656 Product name: Recombinant human HNRNPA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-320 aa of BC009600 Sequence: MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSGRRF Predict reactive species\nFull Name: heterogeneous nuclear ribonucleoprotein A1\nCalculated Molecular Weight: 34 kDa\nObserved Molecular Weight: 34, 40 kDa\nGenBank Accession Number: BC009600\nGene Symbol: HNRNPA1\nGene ID (NCBI): 3178\nRRID: AB_2117177\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P09651\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868848115881,"sku":"11176-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11176-1-ap","provider":"Iright","version":"1.0","type":"link"}