{"product_id":"proteintech-11180-2-ap","title":"Proteintech, 11180-2-AP, PCNP Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PCNP (11180-2-AP) by Proteintech is a Polyclonal antibody targeting PCNP in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human samples\n11180-2-AP targets PCNP in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, HepG2 cells\nPositive IP detected in: HepG2 cells\nPositive IHC detected in: human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPCNP can be detected as 24-28 kDa after posttranslational modification.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1663 Product name: Recombinant human PCNP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-130 aa of BC013916 Sequence: MADGKAGDEKPEKSQRAGAAGGPEEEAEKPVKTKTVSSSNGGESSSRSAEKRSAEEEAADLPTKPTKISKFGFAIGSQTTKKASAISIKLGSSKPKETVPTLAPKTLSVAAAFNEDEDGYTNISWTKLLQ Predict reactive species\nFull Name: PEST proteolytic signal containing nuclear protein\nCalculated Molecular Weight: 19 kDa\nObserved Molecular Weight: 24-28 kDa\nGenBank Accession Number: BC013916\nGene Symbol: PCNP\nGene ID (NCBI): 57092\nRRID: AB_2160652\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8WW12\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869570650281,"sku":"11180-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11180-2-ap","provider":"Iright","version":"1.0","type":"link"}