{"product_id":"proteintech-11211-1-ap","title":"Proteintech, 11211-1-AP, CRIPT Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CRIPT (11211-1-AP) by Proteintech is a Polyclonal antibody targeting CRIPT in WB, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n11211-1-AP targets CRIPT in WB, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: L02 cells\nPositive IP detected in: L02 cells\nPositive IF\/ICC detected in: L02 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe clustering and immobilization of receptors and ion channels located at specific subcellular sites are believed to be mediated by intracellular proteins that attach these membrane proteins to the cytoskeleton. Receptors and ion channels interact with cytoplasmic proteins, which involved in the modulation or downstream signaling mechanisms of the receptor\/ion channel. CRIPT is the protein that binds to the third PDZ (PDZ3) domain of PSD95, which binds to and clusters a variety of membrane proteins, including Shaker-type potassium channel subunits and NMDA receptor NR2 subunits, via its first 2 N-terminal PDZ domains\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1708 Product name: Recombinant human CRIPT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-101 aa of BC018653 Sequence: MVCEKCEKKLGTVITPDTWKDGARNTTESGGRKLNENKALTSKKARFDPYGKNKFSTCRICKSSVHQPGSHYCQGCAYKKGICAMCGKKVLDTKNYKQTSV Predict reactive species\nFull Name: cysteine-rich PDZ-binding protein\nCalculated Molecular Weight: 11 kDa\nObserved Molecular Weight: 15 kDa\nGenBank Accession Number: BC018653\nGene Symbol: CRIPT\nGene ID (NCBI): 9419\nRRID: AB_2084731\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9P021\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869454192809,"sku":"11211-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11211-1-ap","provider":"Iright","version":"1.0","type":"link"}