{"product_id":"proteintech-11213-1-ap","title":"Proteintech, 11213-1-AP, Nectin 3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Nectin 3 (11213-1-AP) by Proteintech is a Polyclonal antibody targeting Nectin 3 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n11213-1-AP targets Nectin 3 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue, rat testis tissue\nPositive IP detected in: mouse testis tissue\nPositive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNectin 3, also known as CD113, is a member of the nectin family of cell adhesion molecules. It plays a crucial role in cell-cell adhesion and the formation of adherens junctions, which are essential for maintaining tissue integrity and cell polarity. Nectin 3 can form homophilic and heterophilic interactions, meaning it can bind to itself or other nectin family members, such as Nectin-2 (PMID: 10744716; 22902367). These interactions are important for processes like cell migration, tissue development, and immune cell transmigration (PMID: 12901789; 24116228).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1712 Product name: Recombinant human PVRL3, Nectin 3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 449-549 aa of BC017572 Sequence: MQKESQIDVLQQDELDSYPDSVKKENKNPVNNLIRKDYLEEPEKTQWNNVENLNRFERPMDYYEDLKMGMKFVSDEHYDENEDDLVSHVDGSVISRREWYV Predict reactive species\nFull Name: poliovirus receptor-related 3\nCalculated Molecular Weight: 61 kDa\nObserved Molecular Weight: 70-80 kDa\nGenBank Accession Number: BC017572\nGene Symbol: Nectin-3\nGene ID (NCBI): 25945\nRRID: AB_2269095\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NQS3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868970766505,"sku":"11213-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11213-1-ap","provider":"Iright","version":"1.0","type":"link"}