{"product_id":"proteintech-11229-1-ap","title":"Proteintech, 11229-1-AP, MAP4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MAP4 (11229-1-AP) by Proteintech is a Polyclonal antibody targeting MAP4 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples\n11229-1-AP targets MAP4 in WB, IHC, IF, IP, IP-MS, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293 cells,  C6 cells,  C2C12 cells,  HepG2 cells\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: human oesophagus cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMAP4 is a ubiquitously expressed microtubule-associated protein involved in the organization and stabilization of microtubules during various cellular activities. Recently it has been reported that expression of MAP4 was upregulated in esophageal squamous cell carcinoma (ESCC). MAP4 has been considered as an independent prognostic factor for ESCC. The predicted molecular weight of MAP4 is about 120 kDa, while higher molecular weight around 200-250 kDa is usually observed in WB test, which may be the result of glycosylation. (26876215, 8647865)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1741 Product name: Recombinant human MAP4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 629-979 aa of BC012794 Sequence: KSTQTVAKTTTAAAVASTGPSSRSPSTLLPKKPTAIKTEGKPAEVKKMTAKSVPADLSRPKSTSTSSMKKTTTLSGTAPAAGVVPSRVKATPMPSRPSTTPFIDKKPTSAKPSSTTPRLSRLATNTSAPDLKNVRSKVGSTENIKHQPGGGRAKVEKKTEAAATTRKPESNAVTKTAGPIASAQKQPAGKVQIVSKKVSYSHIQSKCGSKDNIKHVPGGGNVQIQNKKVDISKVSSKCGSKANIKHKPGGGDVKIESQKLNFKEKAQAKVGSLDNVGHLPAGGAVKTEGGGSEAPLCPGPPAGEEPAISEAAPEAGAPTSASGLNGHPTLSGGGDQREAQTLDSQIQETSI Predict reactive species\nFull Name: microtubule-associated protein 4\nCalculated Molecular Weight: 121 kDa\nObserved Molecular Weight: 210-240 kDa\nGenBank Accession Number: BC012794\nGene Symbol: MAP4\nGene ID (NCBI): 4134\nRRID: AB_2140681\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P27816\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868876689577,"sku":"11229-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11229-1-ap","provider":"Iright","version":"1.0","type":"link"}