{"product_id":"proteintech-11242-1-ap","title":"Proteintech, 11242-1-AP, COXIV Polyclonal antibody","description":"Size: 150ul\nThe COXIV (11242-1-AP) by Proteintech is a Polyclonal antibody targeting COXIV in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n11242-1-AP targets COXIV in WB, IHC, IF\/ICC, IP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  rat liver tissue,  rat brain tissue,  MCF-7 cells,  NIH\/3T3 cells,  Jurkat cells,  mouse skeletal muscle tissue\nPositive IP detected in: mouse skeletal muscle tissue\nPositive IHC detected in: human prostate cancer tissue, human pancreas cancer tissue,  human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:20000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCOX4I1, also named as COX4 and COXIV-1, belongs to the cytochrome c oxidase IV family. It is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. COX4I1 is a marker for mitochondria. It has two isoforms (isoform 1 and 2). Isoform 1(COX4I1) is ubiquitously expressed and isoform 2 is highly expressed in lung tissues. COX4I1 is commonly used as a loading control. This antibody was generated against full length COX4I1 protein and cross reacts with COX4I2.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, pig, canine, bovine, goat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1640 Product name: Recombinant human COXIV protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-169 aa of BC021236 Sequence: MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK Predict reactive species\nFull Name: cytochrome c oxidase subunit IV isoform 1\nCalculated Molecular Weight: 19.6 kDa\nObserved Molecular Weight: 17-18 kDa\nGenBank Accession Number: BC021236\nGene Symbol: COX IV\nGene ID (NCBI): 1327\nRRID: AB_2085278\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P13073\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868819607721,"sku":"11242-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11242-1-ap","provider":"Iright","version":"1.0","type":"link"}