{"product_id":"proteintech-11295-1-ap","title":"Proteintech, 11295-1-AP, SPIRE1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SPIRE1 (11295-1-AP) by Proteintech is a Polyclonal antibody targeting SPIRE1 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n11295-1-AP targets SPIRE1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  SH-SY5Y cells\nPositive IHC detected in: human lung cancer tissue, mouse stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSPIRE1, Protein spire homolog 1, belongs to the family of Wiskott-Aldrich homology region-2 (WH2) proteins (PMID: 11747823). SPIRE1 acts as an actin nucleation factor, associated with the slow-growing pointed end of the new filament (PMID: 11747823, PMID: 21620703). SPIRE1 and FMN2 promote assembly of nuclear actin filaments in response to DNA damage in order to facilitate movement of chromatin and repair factors after DNA damage (PMID: 26287480).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1798 Product name: Recombinant human SPIRE1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 600-756 aa of BC016825 Sequence: GRFSFFTWSYTCQFCKRPVCSQCCKKMRLPSKPYSTLPIFSLGPSALQRGESSMRSEKPSTAHHRPLRSIARFSSKSKSMDKSDEELQFPKELMEDWSTMEVCVDCKKFISEIISSSRRSLVLANKRARLKRKTQSFYMSSPGPSEYCPSERTISEI Predict reactive species\nFull Name: spire homolog 1 (Drosophila)\nCalculated Molecular Weight: 64 kDa\nObserved Molecular Weight: 50-60 kDa, 95 kDa\nGenBank Accession Number: BC016825\nGene Symbol: SPIRE1\nGene ID (NCBI): 56907\nRRID: AB_3085370\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q08AE8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887815119017,"sku":"11295-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11295-1-ap","provider":"Iright","version":"1.0","type":"link"}