{"product_id":"proteintech-11326-1-ap","title":"Proteintech, 11326-1-AP, LAT Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LAT (11326-1-AP) by Proteintech is a Polyclonal antibody targeting LAT in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse samples\n11326-1-AP targets LAT in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, mouse thymus\nPositive IP detected in: Jurkat cells\nPositive IHC detected in: human thymus tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLAT is a membrane-localized adaptor protein which is primarily concentrated in microdomains by palmitoylation. LAT plays a central role in T-cell activation by nucleating signaling complexes that are critical for the propagation of T-cell signals from the plasma membrane to the cellular interior. In addition to being a positive regulator of T cell signaling, LAT also recruits several negative regulatory proteins, including kinases, phosphatases, and ubiquitin ligases, which ultimately leads to signal termination. LAT is subject to ubiquitylation, and ubiquitin-resistant mutants of LAT display enhanced signaling.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1868 Product name: Recombinant human LAT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-233 aa of BC011563 Sequence: MEEAILVPCVLGLLLLPILAMLMALCVHCHRLPGSYDSTSSDSLYPRGIQFKRPHTVAPWPPAYPPVTSYPPLSQPDLLPIPRSPQPLGGSHRTPSSRRDSDGANSVASYENEEPACEDADEDEDDYHNPGYLVVLPDSTPATSTAAPSAPALSTPGIRDSAFSMESIDDYVNVPESGESAEASLDGSREYVNVSQELHPGAAKTEPAALSSQEAEEVEEEGAPDYENLQELN Predict reactive species\nFull Name: linker for activation of T cells\nCalculated Molecular Weight: 262 aa, 28 kDa\nObserved Molecular Weight: 36-38 kDa\nGenBank Accession Number: BC011563\nGene Symbol: LAT\nGene ID (NCBI): 27040\nRRID: AB_10695624\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O43561\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868918894761,"sku":"11326-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-11326-1-ap","provider":"Iright","version":"1.0","type":"link"}